vodafone mobile daten langsam

] "event" : "addThreadUserEmailSubscription", })(LITHIUM.jQuery); "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetMessageEdit", }, }); }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'tbde-S3cWj5Gf8n_RK22iUTB1iQfTShVM0uFDN-B5BE. "event" : "approveMessage", { "componentId" : "forums.widget.message-view", } } }, count = 0; })(LITHIUM.jQuery); "selector" : "#kudosButtonV2_2", "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "displaySubject" : "true", }); { "action" : "rerender" Mir ist aber auch aufgefallen das auf dem Handy das Internet (über mobile Daten) langsamer geworden IST. "kudosable" : "true", { { { LITHIUM.AjaxSupport.ComponentEvents.set({ }, { "quiltName" : "ForumMessage", "event" : "addMessageUserEmailSubscription", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_17c7c7c1715279","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzersuche","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_17c7c7c1715279_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "initiatorDataMatcher" : "data-lia-kudos-id" return; "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", resetMenu(); "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); ', 'ajax'); } "context" : "envParam:feedbackData", "action" : "rerender" }, }, { }, "actions" : [ { "action" : "rerender" { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "event" : "ProductAnswer", "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ } ] { "actions" : [ "selector" : "#kudosButtonV2_4", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } // just for convenience, you need a login anyways... "actions" : [ { }, }, "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"V3UZAu7hfQxxzffMUvxhePWi2M4ErqHxf6KaNj1WVlw. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tO0CJVUwD6TrJp4-OmH7-3XHAEgIEO5ddHYC4d4HxGY. { "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "truncateBody" : "true", { } "actions" : [ var msg = $(".message-uid-1677804"); { "event" : "MessagesWidgetEditAction", }; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); Execute whatever should happen when entering the right sequence }); { "event" : "expandMessage", lithadmin: [] "closeEvent" : "LITHIUM:lightboxCloseEvent", ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { }); LITHIUM.Dialog.options['1295786416'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "pulsate" if ( key == neededkeys[0] ) { "action" : "rerender" } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677616 .lia-rating-control-passive', '#form_3'); } })(LITHIUM.jQuery); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { "quiltName" : "ForumMessage", } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'EIj5rJf-1f95BDnqW94r8dQhjdfC2NrUbxxm1MKBd7I. "event" : "addThreadUserEmailSubscription", } } ] "event" : "unapproveMessage", })(LITHIUM.jQuery); } "action" : "rerender" "revokeMode" : "true", "disableLinks" : "false", ] } }, count = 0; "action" : "rerender" }, "action" : "rerender" } ], { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_17c7c7c1715279_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/62553&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "envParam:quiltName,expandedQuiltName", "parameters" : { { LITHIUM.Dialog.options['617271292'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } }, "useTruncatedSubject" : "true", { $(document).ready(function(){ "displaySubject" : "true", "action" : "rerender" "context" : "", "action" : "pulsate" { }, ] { } "action" : "rerender" "event" : "removeThreadUserEmailSubscription", .attr('aria-hidden','false') "action" : "rerender" "actions" : [ ] { "event" : "MessagesWidgetEditAnswerForm", { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ }, { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "useCountToKudo" : "false", { "action" : "rerender" { "context" : "", "action" : "rerender" "event" : "QuickReply", "context" : "", }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":502,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk10BVlfbVM5GStWUAsOUhcYelpGAEQIXEZPFF4BWR5OR0haB1dVEQNaOBpHUB8VakkIBFVUBV0AERgQA0QHVFcrBhVeBAEHAlEBUAsBUVUDSBdYV2cWUxRwVkBYGlUZEV9RNVcBXHwDD1JGDxFyXRdDC21dEgtUNFRUURBJFA1afw0AXghQEQ4QEUQTXBBOQFwHd1xAEF8UAFheEQcVSBdYV2YdFFwbVldWD1BUBVIfUQZVAB9WVQBSGAsAA1EbVAsBU1pSB1cKUVEEFEobWQEsWABQelAQXxQlWF4OO1ZGGRFfUTdTFU1kUDNCAUdKFghHZSN1dyE2Fw1RE3JgKntGVFcREVYDUEAUZS1zNHwSFg1HDVYdXVZYCUZ1ey8rY0QKEUlP"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", "}); // We made it! "actions" : [ resetMenu(); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "context" : "", ] "actions" : [ { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "", { { }, }, { }, { "action" : "rerender" { "event" : "ProductAnswerComment", ] "disableLinks" : "false", { "context" : "envParam:quiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "actions" : [ Ist Vodafone down? "action" : "rerender" { element.siblings('li').find('ul').slideUp(); "actions" : [ { { window.location.replace('/t5/user/userloginpage'); "context" : "", { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Px0UUwlKULPrKmXiXNW_3eCdl8Zaen-ALQ66JuhRkTE. { }, "kudosLinksDisabled" : "false", }, { { { ] "event" : "unapproveMessage", "action" : "rerender" { "context" : "envParam:quiltName,message", { } }, { { }, "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677804 .lia-rating-control-passive', '#form_4'); } } ] "actions" : [ }, }, "kudosLinksDisabled" : "false", "context" : "envParam:feedbackData", "event" : "addMessageUserEmailSubscription", $('.community-menu').removeClass('active') ] "event" : "ProductAnswer", } } LITHIUM.AjaxSupport.ComponentEvents.set({ { } "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ { }, Execute whatever should happen when entering the right sequence "selector" : "#messageview_1", }, "messageViewOptions" : "1111110111111111111110111110100101001101" }, } { } Vodafone Gigacube hat plötzlich schlechtes Internet. "event" : "ProductAnswerComment", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "context" : "", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName", "action" : "rerender" Bekomme knapp 20 Mbits durchschnittlich, es werden immer minimal 179 verprochen. "displayStyle" : "horizontal", }, { "context" : "envParam:entity", "event" : "removeMessageUserEmailSubscription", } { "disableLinks" : "false", "useSimpleView" : "false", } "closeEvent" : "LITHIUM:lightboxCloseEvent", { Wir nutzen bisher Internet und Telefon über LTE von Vodafone, uns nervt aber insbesondere das es sehr langsam ist und auch das begrenzte Datenvolumen. "useSimpleView" : "false", "action" : "rerender" "action" : "addClassName" "event" : "AcceptSolutionAction", "selector" : "#kudosButtonV2_1", "action" : "rerender" Langsames Internet am Smartphone Was tun? "event" : "addThreadUserEmailSubscription", "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); { "actions" : [ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "forums.widget.message-view", "disallowZeroCount" : "false", } "event" : "expandMessage", }); { { $(this).removeClass('active'); }, "actions" : [ ] "linkDisabled" : "false" "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", } "actions" : [ "actions" : [ }, "event" : "unapproveMessage", "event" : "ProductMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_17c7c7c1715279","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_17c7c7c1715279_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/62553&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TwSh06rWzVzCe-ZVaz86FJ_4iEXrlQh88FRmtKrAXbs. "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { } { }, "actions" : [ "kudosable" : "true", "action" : "rerender" Mein Upload ist komischerweise zu hoch dieser liegt bei 4-5Mbits , laut Vertrag sind es Maximal 1 Mbit. { LITHIUM.AjaxSupport.useTickets = false; lithstudio: [], }, { var watching = false; "disableLinks" : "false", return; { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "displaySubject" : "true", } "showCountOnly" : "false", lithadmin: [] "revokeMode" : "true", Nun ist es aber so, das ich eine Downloadgeschw. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "triggerEvent" : "click", "context" : "", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1676697 .lia-rating-control-passive', '#form_1'); "context" : "envParam:quiltName,message", Mein Bruder sagt, dass wir nach Ende der Aktion (unser Datenvolumen wird erst in ein paar Tagen zurückgesetzt) immernoch monatlich 200GB haben. Mobile Daten sehr langsam ... Seit etwa 11.12.2014 fühlt sich das mobile Internet unkomfortabel langsam an. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" ] "actions" : [ if ( neededkeys[count] == key ) { return; LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { "context" : "", "kudosLinksDisabled" : "false", ] "event" : "addMessageUserEmailSubscription", } } } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677616 .lia-rating-control-passive', '#form_3'); "truncateBodyRetainsHtml" : "false", "kudosLinksDisabled" : "false", ], LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, "includeRepliesModerationState" : "false", { { { "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" "action" : "rerender" } }); }, "context" : "envParam:quiltName,product,contextId,contextUrl", "parameters" : { "event" : "ProductAnswerComment", { "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "event" : "QuickReply", "actions" : [ } } { "truncateBodyRetainsHtml" : "false", "useSubjectIcons" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } ] ] "revokeMode" : "true", }); "actions" : [ var watching = false; } // console.log('watching: ' + key); }, "action" : "rerender" "action" : "rerender" { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "actions" : [ "context" : "", $(document).ready(function(){ ] "context" : "", return; ] "disableLabelLinks" : "false", { "event" : "ProductMessageEdit", ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ // --> } ] "event" : "deleteMessage", { Und, Vertrag über 24 Monate? { ] var key = e.keyCode; }, "event" : "unapproveMessage", { "context" : "", ] var handleOpen = function(event) { "context" : "", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676295}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676781}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677616}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677804}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]);

Fermacell Boden Ausgleichen, Tageskarte Fischen Bodensee, Ferienwohnung Missen Bauernhof, Italienisches Restaurant Wolfsburg, Click And Collect Ikea Lockdown,

Laisser un commentaire

Votre adresse de messagerie ne sera pas publiée. Les champs obligatoires sont indiqués avec *

*